- PAGE3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49362
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- PAGE3
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: GERGDGPNVK GEFLPNLEPV KIPEAGEGQP SV
- PAGE family member 3
- CT16.6, GAGED1, PAGE-3
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV
Specifications/Features
Available conjugates: Unconjugated